DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and dbx1a

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_571233.1 Gene:dbx1a / 30394 ZFINID:ZDB-GENE-000128-8 Length:314 Species:Danio rerio


Alignment Length:87 Identity:37/87 - (42%)
Similarity:50/87 - (57%) Gaps:3/87 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 AAAFPIARRIGHPYQNRTPPKRKKPRTS-FTRIQVAELEKRFHKQKYLASAERAALARGLKMTDA 259
            ::..||......|...|..|:|...|.: |:.:|...|||.|.||||::..:|..||..|.:.|:
Zfish   153 SSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDS 217

  Fly   260 QVKTWFQNRRTKWRRQTAEERE 281
            |||.||||||.|||  .::|||
Zfish   218 QVKIWFQNRRMKWR--NSKERE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 37/87 (43%)
Homeodomain 218..274 CDD:459649 27/56 (48%)
dbx1aNP_571233.1 Homeodomain 178..232 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..279 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.