DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and TLX3

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_066305.2 Gene:TLX3 / 30012 HGNCID:13532 Length:291 Species:Homo sapiens


Alignment Length:271 Identity:127/271 - (46%)
Similarity:147/271 - (54%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ELLQQEDHDLAYKLATSIANSTYGSAAALY-----------SYPHLYPSAAG------------- 161
            ::|...|.|        .|.:..|...|.|           :||.|..|.||             
Human    22 QILNSPDQD--------SAPAPRGPDGASYLGGPPGGRPGATYPSLPASFAGLGAPFEDAGSYSV 78

  Fly   162 ------GHVLRVPPQRTPLTWALPPLHHAAL----------------------AHQAVKDRLAAA 198
                  ..|:|||..| ||..|:||...:||                      :.:.||||..||
Human    79 NLSLAPAGVIRVPAHR-PLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTAA 142

  Fly   199 -----FPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTD 258
                 |.:.||||||||||||||||||||||:|:|:.|||||||:|||||||||||||:.|||||
Human   143 AALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTD 207

  Fly   259 AQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAEAISKGFAPPSAPLGSQGGVNGAPLAA 323
            |||||||||||||||||||||||||||.|:||||.||.:|..|.......|  ....::.:.|.|
Human   208 AQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQP--DPLCLHNSSLFA 270

  Fly   324 LHGLQPWAEAS 334
            |..||||.|.|
Human   271 LQNLQPWEEDS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 89/123 (72%)
Homeobox 220..273 CDD:278475 45/52 (87%)
TLX3NP_066305.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 7/41 (17%)
Homeobox 169..223 CDD:395001 46/53 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6254
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3780
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1391465at2759
OrthoFinder 1 1.000 - - FOG0001097
OrthoInspector 1 1.000 - - otm40433
orthoMCL 1 0.900 - - OOG6_107582
Panther 1 1.100 - - LDO PTHR45921
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5132
SonicParanoid 1 1.000 - - X1533
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.