DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Nkx1-1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_234082.6 Gene:Nkx1-1 / 298981 RGDID:1564874 Length:443 Species:Rattus norvegicus


Alignment Length:285 Identity:76/285 - (26%)
Similarity:99/285 - (34%) Gaps:99/285 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKL-------------------------ATSIAN 140
            ||..|.|...::..|..||     .||.|.|.::                         |..:..
  Rat   174 SSGSGRSPTADSEDEAPEE-----DEDEDQAPEVQDVQGTEEPRGGSGGLGARGSGCSGAAEVEA 233

  Fly   141 STYGSAAALYSYPHLYPSAAGGHVLRVPPQRTPLTWALPPLHHAALAHQAVKDRLAAAFPIARRI 205
            |....|||        |...|.......|   |:|.|     .|..|....:....|..|..:|.
  Rat   234 SPVDEAAA--------PGPRGNSPGAPGP---PVTAA-----GAGNAGSTPQGAAVATKPKRKRT 282

  Fly   206 GHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRT 270
            |...::..|   ::.||:||..|:..||.:|...:||:..||..||..|.:|:.|||.|||||||
  Rat   283 GSDSKSGKP---RRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVKIWFQNRRT 344

  Fly   271 KWRRQTAEEREAERQAANRLMLSLQAEAISKGFAPPSAPLGSQGGVN------------------ 317
            ||::|...                         |..|||.|..||..                  
  Rat   345 KWKKQNPG-------------------------ADTSAPTGGGGGPGPGAGPGAGLPGGLSPLSP 384

  Fly   318 ----GAPLAALHGLQPWAEASHAAG 338
                |||| ||||  |....:|:.|
  Rat   385 SPPMGAPL-ALHG--PAGYPAHSPG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 39/118 (33%)
Homeobox 220..273 CDD:278475 27/52 (52%)
Nkx1-1XP_234082.6 Homeobox 295..347 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.