DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Tlx3

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_036012630.1 Gene:Tlx3 / 27140 MGIID:1351209 Length:338 Species:Mus musculus


Alignment Length:325 Identity:137/325 - (42%)
Similarity:163/325 - (50%) Gaps:88/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEK 120
            |..|:..|.|| ....|.:.|.|.::|:.|.:             .|:|..      .|..|   
Mouse    46 PRMEAPASAQT-PHPHEPISFGIDQILNSPDQ-------------DSAPAP------RGPDG--- 87

  Fly   121 ELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAG-------------------GHVLR 166
                          |:.:.....|...|  :||.|..|.||                   ..|:|
Mouse    88 --------------ASYLGGPPGGRPGA--AYPSLPASFAGLGAPFEDAGSYSVNLSLAPAGVIR 136

  Fly   167 VPPQRTPLTWALPPLHHAAL----------------------AHQAVKDRLAAA-----FPIARR 204
            ||..| ||..|:||...:||                      :.:.||||..||     |.:.||
Mouse   137 VPAHR-PLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTAAAALTPFTVTRR 200

  Fly   205 IGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRR 269
            ||||||||||||||||||||:|:|:.|||||||:|||||||||||||:.||||||||||||||||
Mouse   201 IGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRR 265

  Fly   270 TKWRRQTAEEREAERQAANRLMLSLQAEAISKGFAPPSAPLGSQGGVNGAPLAALHGLQPWAEAS 334
            ||||||||||||||||.|:||||.||.:|..|.......|  ....::.:.|.||..||||.|.|
Mouse   266 TKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQP--DPLCLHNSSLFALQNLQPWEEDS 328

  Fly   335  334
            Mouse   329  328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 89/123 (72%)
Homeobox 220..273 CDD:278475 45/52 (87%)
Tlx3XP_036012630.1 PRK07764 <20..>109 CDD:236090 20/101 (20%)
Homeobox 216..270 CDD:395001 46/53 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6244
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3771
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1391465at2759
OrthoFinder 1 1.000 - - FOG0001097
OrthoInspector 1 1.000 - - otm42509
orthoMCL 1 0.900 - - OOG6_107582
Panther 1 1.100 - - LDO PTHR45921
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1533
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.