DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Dbx2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_997416.2 Gene:Dbx2 / 223843 MGIID:107445 Length:377 Species:Mus musculus


Alignment Length:163 Identity:50/163 - (30%)
Similarity:71/163 - (43%) Gaps:26/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 PSAAGGHVLRVPPQRTPLTWALPPLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPR 221
            |||        |....|...:.||.:.|.......:.....||   .|..|.....|.....|.|
Mouse   171 PSA--------PVPSKPFLLSAPPFYSACCGGSCRRPASPTAF---SREEHGLPLLTQDSNSKAR 224

  Fly   222 TS------FTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEER 280
            ..      |:..|...|||.|.||||::..:|..||..|.:.::|||.||||||.|||  .::|:
Mouse   225 RGILRRAVFSEEQRKALEKMFQKQKYISKTDRRKLAVSLGLKESQVKIWFQNRRMKWR--NSKEK 287

  Fly   281 EAERQAANRLM--LSLQAEAISKGF--APPSAP 309
            |.   .::|.:  :|||.:.:::..  .||..|
Mouse   288 EV---LSSRCLQEVSLQEDRLARPAVGCPPQCP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 42/124 (34%)
Homeobox 220..273 CDD:278475 25/58 (43%)
Dbx2NP_997416.2 COG5576 <217..334 CDD:227863 37/106 (35%)
Homeobox 229..282 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.