DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Tlx2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_033418.1 Gene:Tlx2 / 21909 MGIID:1350935 Length:284 Species:Mus musculus


Alignment Length:294 Identity:133/294 - (45%)
Similarity:154/294 - (52%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ENLPFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLAT 136
            |.:.|.|.::||.|                ..||.......||:...|........|        
Mouse    15 EPISFGIDQILSGP----------------EPPGGGLGPGQSGQSHGESAAFSSGFH-------- 55

  Fly   137 SIANSTYGSAAALYSYPHLYPSAAG-GHVLRVPPQRTPLTWALPPLHHAALA------------- 187
              ..|.|..|.:|.|.|.  .|..| |.|:|||..| ||  .:||...||.|             
Mouse    56 --GASGYAPAGSLASLPR--GSGVGPGGVIRVPAHR-PL--PVPPPSGAAPAVPGPSGLGGAGGL 113

  Fly   188 -----------HQAVKDRLAAA---FPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHK 238
                       .:..||||.||   |...||||||||||||||||||||||:|.||.|||:||.:
Mouse   114 AGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLR 178

  Fly   239 QKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAEAISKGF 303
            |||||||||||||:.|:|||||||||||||||||||||||||||||..|.||:|.||.:|:.:..
Mouse   179 QKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPL 243

  Fly   304 APPSAPLGSQGGVNGAPLAALHGLQPWAEASHAA 337
            .||..|  ....::.:.|.||..||||||.:..|
Mouse   244 RPPLPP--DPLCLHNSSLFALQNLQPWAEDNKVA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 86/121 (71%)
Homeobox 220..273 CDD:278475 43/52 (83%)
Tlx2NP_033418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..52 9/47 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..104 13/28 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..166 22/25 (88%)
Homeobox 160..213 CDD:306543 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11290
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3771
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001097
OrthoInspector 1 1.000 - - otm42509
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45921
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5132
SonicParanoid 1 1.000 - - X1533
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.950

Return to query results.
Submit another query.