DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and ceh-31

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_508525.3 Gene:ceh-31 / 191621 WormBaseID:WBGene00000452 Length:260 Species:Caenorhabditis elegans


Alignment Length:105 Identity:45/105 - (42%)
Similarity:59/105 - (56%) Gaps:11/105 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 PIARRIGHPYQNRT---------PPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLK 255
            |.:.|||.|...|:         ..|.:|.||.||..|:.|||..|.|||||:..:|..||..:.
 Worm    68 PSSPRIGSPNTERSVNESPTCVGSKKARKARTIFTDKQLQELENTFEKQKYLSVQDRMELAHRMG 132

  Fly   256 MTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQ 295
            :||.|||||:|||||||:||.:...:....|.|  |.::|
 Worm   133 LTDTQVKTWYQNRRTKWKRQASVGMDLLHDAGN--MAAVQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 45/105 (43%)
Homeobox 220..273 CDD:278475 30/52 (58%)
ceh-31NP_508525.3 Homeobox 98..150 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.