powered by:
Protein Alignment C15 and ceh-1
DIOPT Version :9
Sequence 1: | NP_476873.2 |
Gene: | C15 / 42544 |
FlyBaseID: | FBgn0004863 |
Length: | 339 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508796.2 |
Gene: | ceh-1 / 191614 |
WormBaseID: | WBGene00000428 |
Length: | 171 |
Species: | Caenorhabditis elegans |
Alignment Length: | 59 |
Identity: | 28/59 - (47%) |
Similarity: | 41/59 - (69%) |
Gaps: | 0/59 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 216 KRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRR 274
|.::.||:||..|:..||.:|...:||:..||..||..|::::.|||.|||||||||::
Worm 39 KMRRARTAFTYEQLVALENKFKTSRYLSVVERLNLAIQLQLSETQVKIWFQNRRTKWKK 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0488 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.