DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Nkx2-9

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_032727.2 Gene:Nkx2-9 / 18094 MGIID:1270158 Length:235 Species:Mus musculus


Alignment Length:64 Identity:33/64 - (51%)
Similarity:44/64 - (68%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 PPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTA 277
            |.||:|.|..|::.|..|||:||.:|:||::.||..|||.|::|..|||.||||.|.|.:|..|
Mouse    78 PEKRRKRRVLFSKAQTLELERRFRQQRYLSAPEREQLARLLRLTPTQVKIWFQNHRYKLKRGRA 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 33/64 (52%)
Homeodomain 218..274 CDD:459649 28/55 (51%)
Nkx2-9NP_032727.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..86 4/7 (57%)
Homeodomain 82..138 CDD:459649 28/55 (51%)

Return to query results.
Submit another query.