DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Nkx2-2

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_035049.1 Gene:Nkx2-2 / 18088 MGIID:97347 Length:273 Species:Mus musculus


Alignment Length:128 Identity:43/128 - (33%)
Similarity:59/128 - (46%) Gaps:28/128 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 KRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEER 280
            |::|.|..|::.|..|||:||.:|:||::.||..||..:::|..|||.||||.|.|.:|..||  
Mouse   127 KKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAE-- 189

  Fly   281 EAERQAANRLMLSLQAEAISKGFAPPSAPLGSQGGV-----NGAPLAALHGLQPWAEASHAAG 338
                                ||......|...:..|     :|.|..||.. |..|.|:..||
Mouse   190 --------------------KGMEVTPLPSPRRVAVPVLVRDGKPCHALKA-QDLAAATFQAG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 33/98 (34%)
Homeodomain 218..274 CDD:459649 26/55 (47%)
Nkx2-2NP_035049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..131 1/3 (33%)
Homeodomain 129..185 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.