DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and ceh-51

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_507685.1 Gene:ceh-51 / 180233 WormBaseID:WBGene00013583 Length:234 Species:Caenorhabditis elegans


Alignment Length:285 Identity:72/285 - (25%)
Similarity:106/285 - (37%) Gaps:85/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SGSDVDMDGGSCYDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHNNNNHLLSS 102
            |.|:.:::.|..|    .||          |||:.|...:|:......:.|          :.||
 Worm     2 SSSNYNINNGGDY----YPL----------SSSNLNSTSAITNATVMEYST----------MPSS 42

  Fly   103 SPGSSSNN---------NNSGEKGEEKELLQQED------------HDLAYKLATSIANSTYGSA 146
            ||||.|::         .:.....:..:|..|:.            |..||:...........|.
 Worm    43 SPGSMSSSPAYPAAYQAPSPCYVADPNQLYYQQQLAHNGNDMLVQAHAQAYQAQCFAWFQQQYSQ 107

  Fly   147 AALYSYPHLYPSAAGGHVLRVPPQRTPLTWALPP--LHHAALAHQAVKDRLAAAFPIARRIGHPY 209
            .:..|:||  |..| .|...:||         ||  |||   .||.                || 
 Worm   108 LSPSSFPH--PMVA-HHAGFIPP---------PPSFLHH---QHQQ----------------HP- 140

  Fly   210 QNRTP-PKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWR 273
              |.| .||:..||.|:..|:..|..||.:...:...||..|...:.::..|:|.||||||.|.|
 Worm   141 --RAPSEKRRGARTPFSDSQLYALRTRFEQCDTIKVDERRKLGAVIGLSPEQIKIWFQNRRFKLR 203

  Fly   274 RQTAEEREAERQAANRLMLSLQAEA 298
            :   |:.:..:|.|.:...|.:.||
 Worm   204 K---EKYKQIKQDAVQQQKSAKEEA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 32/104 (31%)
Homeobox 220..273 CDD:278475 19/52 (37%)
ceh-51NP_507685.1 Homeobox 151..204 CDD:365835 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.