DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Lbx2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_034822.1 Gene:Lbx2 / 16815 MGIID:1342288 Length:195 Species:Mus musculus


Alignment Length:146 Identity:54/146 - (36%)
Similarity:65/146 - (44%) Gaps:31/146 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 HVLRVP--------PQRTPLTWALPPLHHA---------ALAHQAVKDRLAAAFPIARRIGHPYQ 210
            |..|.|        |...|...:.|.|..|         ||...|.|..|..:   .|....|.:
Mouse     5 HQRRTPFSIADILGPSMVPEAPSAPQLPEAGPDPASPLCALEELASKTFLGHS---PRATPQPSE 66

  Fly   211 NRTPP-----------KRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTW 264
            .|..|           :|:|.||:||..||.|||:||..|||||.:||..||..|.:.:|||.||
Mouse    67 GRAAPEAPPGPGAGVRRRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLAARLGLANAQVVTW 131

  Fly   265 FQNRRTKWRRQTAEER 280
            |||||.|.:|...|.|
Mouse   132 FQNRRAKLKRDVEEMR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 41/96 (43%)
Homeobox 220..273 CDD:278475 32/52 (62%)
Lbx2NP_034822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 19/86 (22%)
Homeobox 87..140 CDD:278475 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..195
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.