DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Hoxd12

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_032300.2 Gene:Hoxd12 / 15432 MGIID:96204 Length:268 Species:Mus musculus


Alignment Length:75 Identity:28/75 - (37%)
Similarity:43/75 - (57%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 GHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRT 270
            |.|: ...|.:.:|.|..:|:.|:||||..|...:::...:|..|:..|.::|.|||.||||||.
Mouse   190 GLPW-GAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRM 253

  Fly   271 KWRRQTAEER 280
            |.:|....|:
Mouse   254 KKKRVVQREQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 28/75 (37%)
Homeodomain 218..274 CDD:459649 23/55 (42%)
Hoxd12NP_032300.2 PHA03247 <37..123 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..124
Homeodomain 201..257 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.