DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Hhex

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_032271.1 Gene:Hhex / 15242 MGIID:96086 Length:271 Species:Mus musculus


Alignment Length:163 Identity:54/163 - (33%)
Similarity:73/163 - (44%) Gaps:39/163 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 HDLAYKLATSIANSTYGSAAALYSYPHL---YPSAAGGHVLRVPPQRTPLTWALPPLHHAALAHQ 189
            |..|..||.:...|.:|  ..||.:|..   |..|    :||..|...||.|:            
Mouse    82 HHPAAALAAAYGPSGFG--GPLYPFPRTVNDYTHA----LLRHDPLGKPLLWS------------ 128

  Fly   190 AVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGL 254
                              |:..|...|||..:..|:..|..||||:|..||||:..||..||:.|
Mouse   129 ------------------PFLQRPLHKRKGGQVRFSNDQTVELEKKFETQKYLSPPERKRLAKML 175

  Fly   255 KMTDAQVKTWFQNRRTKWRRQTAEEREAERQAA 287
            ::::.||||||||||.||||...|..::.::.|
Mouse   176 QLSERQVKTWFQNRRAKWRRLKQENPQSNKKDA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 37/92 (40%)
Homeodomain 218..274 CDD:459649 29/55 (53%)
HhexNP_032271.1 Interaction with SOX13. /evidence=ECO:0000250|UniProtKB:Q03014 1..138 19/91 (21%)
Required for WNT signaling induction. /evidence=ECO:0000250|UniProtKB:Q03014 138..271 34/71 (48%)
Homeodomain 143..195 CDD:459649 28/51 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..271 3/14 (21%)

Return to query results.
Submit another query.