DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and DBX1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001025036.2 Gene:DBX1 / 120237 HGNCID:33185 Length:343 Species:Homo sapiens


Alignment Length:247 Identity:72/247 - (29%)
Similarity:102/247 - (41%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TP---LSESLQSEQTRSSS------------SENLPFSI-SRLLSKPFETSHHHHNNNNHLLSSS 103
            ||   |.:||||..:..||            ...||.|: :..:|.|.:.:.....:.......|
Human    20 TPTLTLPQSLQSAFSGHSSFLVEDLIRISRPPAYLPRSVPTASMSPPRQGAPTALTDTGASDLGS 84

  Fly   104 PGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLR-V 167
            ||..|....|              ...|:..|:......:|..|.|.|.|....|.|   :|: |
Human    85 PGPGSRRGGS--------------PPTAFSPASETTFLKFGVNAILSSGPRTETSPA---LLQSV 132

  Fly   168 PPQRTPLTWALPPLHHA--ALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTS-FTRIQV 229
            ||:    |:|.|....:  .....:.....::..||......|...|..|:|...|.: |:.:|.
Human   133 PPK----TFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQR 193

  Fly   230 AELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEERE 281
            ..|||.|.||||::..:|..||..|.:.|:|||.||||||.|||  .::|||
Human   194 KALEKMFQKQKYISKPDRKKLAAKLGLKDSQVKIWFQNRRMKWR--NSKERE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 37/87 (43%)
Homeobox 220..273 CDD:278475 26/53 (49%)
DBX1NP_001025036.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..100 9/57 (16%)
Homeobox 184..237 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..343 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.