DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Barx2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_038828.2 Gene:Barx2 / 12023 MGIID:109617 Length:283 Species:Mus musculus


Alignment Length:284 Identity:82/284 - (28%)
Similarity:113/284 - (39%) Gaps:68/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLR 166
            ||||.........:.....|:|.:|..|...||      |.|....:|...|....|..|...||
Mouse    10 SSPGQLKAARRRYKTFMIDEILSKETCDYFEKL------SLYSVCPSLVVRPKPLHSCTGSPSLR 68

  Fly   167 VPP-------QRTPLTWALP------PL---HHAALAHQAVKDRLAAAFPIARRI--GHPYQNRT 213
            ..|       |.|.::..:|      |:   |..|.|..|.   .||..|....:  ......:.
Mouse    69 AYPLLSVITRQPTVISHLVPTGSGLTPVLTRHPVAAAEAAA---AAAETPGGEALASSESETEQP 130

  Fly   214 PPKRKKP---RTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQ 275
            .|::|||   ||.||.:|:..|||:|.|||||::.:|..||:.|.:|..|||||:||||.||::.
Mouse   131 TPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKKM 195

  Fly   276 ----------------------TAEEREAERQAANRLMLSLQAEAISKGFAP-----PSAPLGSQ 313
                                  |:||.|||.:..::.......|:..:...|     |.|.|   
Mouse   196 VLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQELLESSERQEEPCDTQEPKACL--- 257

  Fly   314 GGVNGAPLAA---LHGLQPWAEAS 334
                 .||..   :|..|..:|||
Mouse   258 -----VPLEVAEPIHQPQELSEAS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 48/150 (32%)
Homeobox 220..273 CDD:278475 30/55 (55%)
Barx2NP_038828.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..141 8/36 (22%)
Homeobox 140..193 CDD:306543 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..283 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.