DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Barx1

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_031552.2 Gene:Barx1 / 12022 MGIID:103124 Length:254 Species:Mus musculus


Alignment Length:229 Identity:61/229 - (26%)
Similarity:93/229 - (40%) Gaps:72/229 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SETPLSESLQSEQTRSSSSENLPFSISRLL-SKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEK 116
            :|.|..:........:::.|.|.|.:..|| ::||         ::||                 
Mouse    36 TEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPF---------HSHL----------------- 74

  Fly   117 GEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYP---SAAGGHVLRVPPQRTPLTWAL 178
                .:|:.|.                   ||::.:| |.|   |..|..:|...|       .:
Mouse    75 ----AVLKAEQ-------------------AAVFKFP-LAPLGCSGLGSALLAAGP-------GM 108

  Fly   179 P---PLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQK 240
            |   ...|..|..| ::.:|.||       |.........|.::.||.||.:|:..|||||.|||
Mouse   109 PGPAGASHLPLELQ-LRGKLEAA-------GSGEPGAKAKKGRRSRTVFTELQLMGLEKRFEKQK 165

  Fly   241 YLASAERAALARGLKMTDAQVKTWFQNRRTKWRR 274
            ||::.:|..||..|.::..|||||:||||.||::
Mouse   166 YLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 34/79 (43%)
Homeodomain 218..274 CDD:459649 30/55 (55%)
Barx1NP_031552.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Homeodomain 143..199 CDD:459649 30/55 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.