DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Barx1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_031552.2 Gene:Barx1 / 12022 MGIID:103124 Length:254 Species:Mus musculus


Alignment Length:229 Identity:61/229 - (26%)
Similarity:93/229 - (40%) Gaps:72/229 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SETPLSESLQSEQTRSSSSENLPFSISRLL-SKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEK 116
            :|.|..:........:::.|.|.|.:..|| ::||         ::||                 
Mouse    36 TEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPF---------HSHL----------------- 74

  Fly   117 GEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYP---SAAGGHVLRVPPQRTPLTWAL 178
                .:|:.|.                   ||::.:| |.|   |..|..:|...|       .:
Mouse    75 ----AVLKAEQ-------------------AAVFKFP-LAPLGCSGLGSALLAAGP-------GM 108

  Fly   179 P---PLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQK 240
            |   ...|..|..| ::.:|.||       |.........|.::.||.||.:|:..|||||.|||
Mouse   109 PGPAGASHLPLELQ-LRGKLEAA-------GSGEPGAKAKKGRRSRTVFTELQLMGLEKRFEKQK 165

  Fly   241 YLASAERAALARGLKMTDAQVKTWFQNRRTKWRR 274
            ||::.:|..||..|.::..|||||:||||.||::
Mouse   166 YLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 34/79 (43%)
Homeobox 220..273 CDD:278475 29/52 (56%)
Barx1NP_031552.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Homeobox 145..198 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.