DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and LBX1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_006553.2 Gene:LBX1 / 10660 HGNCID:16960 Length:281 Species:Homo sapiens


Alignment Length:294 Identity:83/294 - (28%)
Similarity:123/294 - (41%) Gaps:77/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EQTRSSSSENL-----------PFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKG 117
            |:.|.|..::|           ||||..:|:||.....:......|||:    ::..:...|...
Human    13 EERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLA----AADKHAQGGLPL 73

  Fly   118 EEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLRVPPQRTPLTWALPPLH 182
            ..:.||.|.....|.:   .:|:.|:.....              .||:....|..:|       
Human    74 AGRALLSQTSPLCALE---ELASKTFKGLEV--------------SVLQAAEGRDGMT------- 114

  Fly   183 HAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAER 247
                                 ..|   |.:||.||:|.||:||..|:.||||||..||||:.|:|
Human   115 ---------------------IFG---QRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADR 155

  Fly   248 AALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAE--AISKGFAPPSAPL 310
            ..:|:.|.:|:|||.|||||||.|.:|. .||.:|:.::|.:|..|.|.:  |:::......|..
Human   156 DQIAQQLGLTNAQVITWFQNRRAKLKRD-LEEMKADVESAKKLGPSGQMDIVALAELEQNSEATA 219

  Fly   311 GSQGGVN------GAPLAALHGLQPWAEASHAAG 338
            |..||..      |:|:     |.|.|..:..||
Human   220 GGGGGCGRAKSRPGSPV-----LPPGAPKAPGAG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 49/120 (41%)
Homeobox 220..273 CDD:278475 31/52 (60%)
LBX1NP_006553.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 4/21 (19%)
Homeobox 128..181 CDD:278475 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..281 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.