DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and dbx1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_002940015.1 Gene:dbx1 / 100495433 XenbaseID:XB-GENE-480177 Length:328 Species:Xenopus tropicalis


Alignment Length:247 Identity:76/247 - (30%)
Similarity:104/247 - (42%) Gaps:52/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TPLSESLQSEQTRSSSSENLPFSISRL--LSKP--FETSHHHHNNNNHLLSSSPGSSSNNNNSGE 115
            ||.....||.||..||  :..|.|..|  :|:|  |........:.:...|.||.|.|       
 Frog    20 TPTLTLPQSIQTALSS--HTSFLIEDLIRISRPAGFLPRAVPPPSMSPPTSDSPTSLS------- 75

  Fly   116 KGEEKELLQQEDHDLAYKLA-TSIANST------YGSAAALYSYPH------LYPSAAGGHVLRV 167
                      |..|||.:.| |||:::.      :|..|.|.:.|.      |.||.|       
 Frog    76 ----------EVPDLARREAPTSISSNNSSTFLKFGVNAILSASPRTETCPALPPSVA------- 123

  Fly   168 PPQRTPLTWALPPLHHA--ALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTS-FTRIQV 229
            ||:    .:|.|....:  .....:.....::..||......|...|..|:|...|.: |:.:|.
 Frog   124 PPK----AFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQR 184

  Fly   230 AELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEERE 281
            ..|||.|.||||::..:|..||..|.:.|:|||.||||||.|||  .::|||
 Frog   185 KALEKMFQKQKYISKPDRKKLAGKLGLKDSQVKIWFQNRRMKWR--NSKERE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 37/87 (43%)
Homeobox 220..273 CDD:278475 26/53 (49%)
dbx1XP_002940015.1 Homeobox 175..229 CDD:365835 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.