DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and ventx2.2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_002937178.3 Gene:ventx2.2 / 100494704 XenbaseID:XB-GENE-920515 Length:333 Species:Xenopus tropicalis


Alignment Length:251 Identity:65/251 - (25%)
Similarity:104/251 - (41%) Gaps:81/251 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SDSRMSCGSGSDVDMDGGSCYDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHN 94
            |||..|..|..|.|:   .|..:..||           |:..:|      .||.|  :|:.|.::
 Frog    83 SDSESSLYSNEDEDL---FCEKDLNTP-----------STPGDN------GLLHK--DTATHDYS 125

  Fly    95 NNNHLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSA 159
            ....:.:::|.::| |.::.:.|              |..:|   :|.|.|.|:..|     .:|
 Frog   126 GMVSVPANTPRTTS-NEDAAKSG--------------YSTST---DSGYESEASRSS-----STA 167

  Fly   160 AGGHVLRVPPQRTPLTWALPPLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSF 224
            ..|..          |.:|.|           .|.......:.||:               ||:|
 Frog   168 PEGDA----------TVSLSP-----------NDTSDEEGKLGRRL---------------RTAF 196

  Fly   225 TRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEER 280
            |..|::.|||.|.|.:||.::||..||..|::::.|:||||||||.|::|:..:.|
 Frog   197 TSDQISTLEKTFQKHRYLGASERRKLAAKLQLSEVQIKTWFQNRRMKYKREIQDGR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 31/85 (36%)
Homeobox 220..273 CDD:278475 27/52 (52%)
ventx2.2XP_002937178.3 Homeobox 193..246 CDD:395001 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.