DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and nkx1-1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_002936812.1 Gene:nkx1-1 / 100493120 XenbaseID:XB-GENE-488879 Length:408 Species:Xenopus tropicalis


Alignment Length:342 Identity:83/342 - (24%)
Similarity:108/342 - (31%) Gaps:149/342 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SCGSGSDVDMDGGSCYDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHNNNNHL 99
            ||...::|..:.| .|..|.|   |..|:::                                  
 Frog   140 SCKKSTEVIKEEG-LYQHSAT---EDCQTQE---------------------------------- 166

  Fly   100 LSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHV 164
            .|.||||........|  |::|:..:|.           :|||....|      ...|.|..|. 
 Frog   167 FSPSPGSDLEEEEDEE--EDEEICSEES-----------SNSTPSGLA------ERDPGAGNGQ- 211

  Fly   165 LRVPPQRTPLTWALPPLHHAALAHQAVKDRLAAAFPIARRIGHP------YQNR-TPPKRK---- 218
                                      .:|.|....|.......|      .||: ..||||    
 Frog   212 --------------------------GEDALNTGAPAGSNQQQPTGKNQQQQNQHGKPKRKRTGS 250

  Fly   219 -----KP---RTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQ 275
                 ||   ||:||..|:..||.:|...:||:..||..||..|.:|:.|||.|||||||||::|
 Frog   251 DSKSGKPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQ 315

  Fly   276 TAEEREAERQAANRLMLSLQAEAISKGFAPPSAPLGSQGGVNG----------APLA-------- 322
            ...                         |..|||.|..|...|          :||:        
 Frog   316 NPG-------------------------ADTSAPTGGSGHGGGGSGSVLGGGLSPLSHSPPMGNP 355

  Fly   323 -ALHGLQPWAEASHAAG 338
             ||||...:  .|||.|
 Frog   356 MALHGHHGY--PSHAPG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 44/137 (32%)
Homeobox 220..273 CDD:278475 28/55 (51%)
nkx1-1XP_002936812.1 Homeobox 261..314 CDD:365835 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.