DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and nkx1-2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_002937845.1 Gene:nkx1-2 / 100486193 XenbaseID:XB-GENE-854960 Length:246 Species:Xenopus tropicalis


Alignment Length:60 Identity:31/60 - (51%)
Similarity:42/60 - (70%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 KRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQ 275
            |.::.||:||..|:..||.||...:||:..||.:||..|.:|:.|||.|||||||||::|
 Frog    99 KPRRARTAFTYEQLVALESRFRSSRYLSVCERLSLALTLHLTETQVKIWFQNRRTKWKKQ 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 31/60 (52%)
Homeobox 220..273 CDD:278475 28/52 (54%)
nkx1-2XP_002937845.1 Homeobox 104..157 CDD:365835 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.