powered by:
Protein Alignment C15 and nkx1-2
DIOPT Version :9
Sequence 1: | NP_476873.2 |
Gene: | C15 / 42544 |
FlyBaseID: | FBgn0004863 |
Length: | 339 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002937845.1 |
Gene: | nkx1-2 / 100486193 |
XenbaseID: | XB-GENE-854960 |
Length: | 246 |
Species: | Xenopus tropicalis |
Alignment Length: | 60 |
Identity: | 31/60 - (51%) |
Similarity: | 42/60 - (70%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 216 KRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQ 275
|.::.||:||..|:..||.||...:||:..||.:||..|.:|:.|||.|||||||||::|
Frog 99 KPRRARTAFTYEQLVALESRFRSSRYLSVCERLSLALTLHLTETQVKIWFQNRRTKWKKQ 158
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.