DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and LOC100008066

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_003199819.1 Gene:LOC100008066 / 100008066 -ID:- Length:251 Species:Danio rerio


Alignment Length:203 Identity:116/203 - (57%)
Similarity:137/203 - (67%) Gaps:31/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 YGSAAALYSYPHLYPSAAGGHVLRVPPQRTPLTWALPPLHHAALA---------HQAVKDRLAAA 198
            :|.::||..          |.|:|||..| ||.   |.:..||.|         .:..||||.|.
Zfish    58 FGVSSALLP----------GGVIRVPAHR-PLA---PAMMSAAPALCFPWMDNNRRFPKDRLPAL 108

  Fly   199 FP--IARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQV 261
            .|  :.||||||||||||||||||||||:|:|:.|||||||:|||||||||||||:.||||||||
Zfish   109 IPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQV 173

  Fly   262 KTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAEAISKGFAP--PSAPLGSQGGVNGAPLAAL 324
            |||||||||||||||||||||.||.|||::|.|||:|:.|..:.  .|.||    .::.:.|.||
Zfish   174 KTWFQNRRTKWRRQTAEEREAGRQQANRMLLQLQADALQKSISESVSSDPL----CLHNSSLYAL 234

  Fly   325 HGLQPWAE 332
            ..|||||:
Zfish   235 QNLQPWAQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 89/122 (73%)
Homeobox 220..273 CDD:278475 45/52 (87%)
LOC100008066XP_003199819.1 Homeobox 132..185 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6179
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3558
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1391465at2759
OrthoFinder 1 1.000 - - FOG0001097
OrthoInspector 1 1.000 - - otm25118
orthoMCL 1 0.900 - - OOG6_107582
Panther 1 1.100 - - O PTHR45921
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.