DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HB18

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_177248.3 Gene:HB18 / 843431 AraportID:AT1G70920 Length:206 Species:Arabidopsis thaliana


Alignment Length:131 Identity:39/131 - (29%)
Similarity:62/131 - (47%) Gaps:22/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 KDFDESQ------DKS-------HLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPA 381
            :|||.:|      |:.       |::...:....::::|.|  .|..|...||:.|:....|:|.
plant    32 RDFDINQTPKTEEDREWMIGATPHVNEDDSNSGGRRRKKLR--LTKEQSHLLEESFIQNHTLTPK 94

  Fly   382 DRDEIAASLGLSNAQVITWFQNRRAKQK-----RDIEELKKDFDSVKVFSAHKSFLENVNDLSIL 441
            .:.::|..|.||..||..|||||||:.|     .:.|.||:.|.|:|  ..::.....|.:|..|
plant    95 QKKDLATFLKLSQRQVEVWFQNRRARSKLKHTEMECEYLKRWFGSLK--EQNRRLQIEVEELRAL 157

  Fly   442 K 442
            |
plant   158 K 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 22/58 (38%)
HB18NP_177248.3 HOX 66..122 CDD:197696 22/57 (39%)
HALZ 124..167 CDD:420073 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.