DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HB51

DIOPT Version :10

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:129 Identity:29/129 - (22%)
Similarity:54/129 - (41%) Gaps:34/129 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EDEIQYLISDKKEKRSPKAHVNAVFF--------NQLRTLLGIIIPK-KWS------VENGL-LV 91
            |.|.||.:|.          ::.|.|        |.:|.....::|. .|.      |.|.| |.
plant    81 EYEDQYTLST----------LDYVIFDPGVFCEKNSVREFASYVLPPIYWCVFLFGLVGNSLVLA 135

  Fly    92 VIALSLIARSVSDIWMIQNATAIESTIITM--------NKKQFRTALVKYLSALPAIAVVNNVL 147
            |...:...::::|.::|..|.|....:||:        :...|:|||.|.::::.::.|.:.:|
plant   136 VYVYNRKLKTMTDTFLINLAIADILFLITLPFWAIAASHDWVFKTALCKAVNSMYSVNVYSGML 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeodomain 354..410 CDD:459649
HB51NP_195999.2 Homeodomain 77..130 CDD:459649 12/58 (21%)
HALZ 132..166 CDD:460477 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.