DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HAT14

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_196289.2 Gene:HAT14 / 830560 AraportID:AT5G06710 Length:336 Species:Arabidopsis thaliana


Alignment Length:284 Identity:69/284 - (24%)
Similarity:104/284 - (36%) Gaps:68/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 ALDYHRQLQEHF------NAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEK 287
            ::|...|||.||      |::.:....|.:..|.:..|:...|.:..|.|.:......|..|   
plant    85 SVDPPLQLQLHFPNWLPENSKGRQGGRMPLGAATVVEEEEEEEEAVPSMSVSPPDSVTSSFQ--- 146

  Fly   288 LEKLTTQEGSEEAQKKK---SEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQ 349
            |:......|.|....|:   .|.:.:.|..||.|..            ||           |...
plant   147 LDFGIKSYGYERRSNKRDIDDEVERSASRASNEDND------------DE-----------NGST 188

  Fly   350 PKKKR--KSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR-- 410
            .||.|  |.::||       ||..|.....|:|..:..:|..|.|...||..|||||||:.|.  
plant   189 RKKLRLSKDQSAF-------LEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTKLKQ 246

  Fly   411 ---DIEELKKDFDSVKVFSAHKSFLENVNDLSILK-KKPMH------------ESDMVGLAAA-- 457
               |.|.||:..:|:.  ..::...:.|.:|..|| ..|.:            ..:.|..:||  
plant   247 TEVDCEYLKRCCESLT--EENRRLQKEVKELRTLKTSTPFYMQLPATTLTMCPSCERVATSAAQP 309

  Fly   458 --AAAAGMVVPVPGSVPMGGAPPK 479
              :||..:.:.....:|:...|.|
plant   310 STSAAHNLCLSTSSLIPVKPRPAK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 19/53 (36%)
HAT14NP_196289.2 HOX 187..243 CDD:197696 23/62 (37%)
HALZ 245..288 CDD:128634 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.