DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HB-2

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 / 827384 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana


Alignment Length:254 Identity:62/254 - (24%)
Similarity:92/254 - (36%) Gaps:70/254 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 NPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKL--------------TTQEGSEEA--- 300
            ||::..:...||....|.||.|.|.....|......::.              |.:.|.|:|   
plant    26 NPSVSVTPSSSSFGLFRRSSWNESFTSSVPNSDSSQKETRTFIRGIDVNRPPSTAEYGDEDAGVS 90

  Fly   301 ---------QKKKSEEQ----PTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKK 352
                     ..|:||.:    |.||...:.|           :|.|.|:.|..|.          
plant    91 SPNSTVSSSTGKRSEREEDTDPQGSRGISDD-----------EDGDNSRKKLRLS---------- 134

  Fly   353 KRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR-----DI 412
              |.::|.       ||:.|.....|:|..:..:|..|||...||..|||||||:.|.     |.
plant   135 --KDQSAI-------LEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTKLKQTEVDC 190

  Fly   413 EELKKDFDSVKVFSAHKSFLENVNDLSILKKKP---MHESDMVGLAAAAAAAGMVVPVP 468
            |.|::..:::.  ..::...:.|.:|..||..|   ||.|....|....:...:.||.|
plant   191 EFLRRCCENLT--EENRRLQKEVTELRALKLSPQFYMHMSPPTTLTMCPSCEHVSVPPP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 19/53 (36%)
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:282474 17/80 (21%)
HOX 128..182 CDD:197696 22/72 (31%)
HALZ 184..227 CDD:128634 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.