DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HAT3

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:315 Identity:72/315 - (22%)
Similarity:120/315 - (38%) Gaps:84/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 LGPTMPVRPFIPSALLHYEQRLALDYHRQLQ----------EHFNAQAQLLRHMGMNPA----II 257
            |.| ||:..:..|:.:.:.|:...::.:::|          |..:.....||.:.:|.|    ::
plant    27 LNP-MPLASYASSSHMQHMQQSNYNHPQKIQNTWINMFQSSERNSDMRSFLRGIDVNRAPSTVVV 90

  Fly   258 ASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGS---------- 312
            ..||   |.:..||.::..:...|.:::|:  :|....|:....:.:..|....|          
plant    91 DVED---EGAGVSSPNSTVSSVMSGKKSER--ELMAAAGAVGGGRVEDNEIERASCSLGGGSDDE 150

  Fly   313 -GKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQK 376
             |..|||              |.|:              ||.|.|:     .|...||:.|....
plant   151 DGSGNGD--------------DSSR--------------KKLRLSK-----EQALVLEETFKEHS 182

  Fly   377 YLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR-----DIEELKKDFDSVKVFSAHKSFLENVN 436
            .|:|..:..:|..|.|...||..|||||||:.|.     |.|.||:..:::.  ..::...:.|:
plant   183 TLNPKQKMALAKQLNLRTRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLT--DENRRLQKEVS 245

  Fly   437 DLSILKKKP---MHESDMVGL--------AAAAAAAGMVVP--VPGSVPMGGAPP 478
            :|..||..|   ||......|        .|..:::..|.|  :..|.|||...|
plant   246 ELRALKLSPHLYMHMKPPTTLTMCPSCERVAVTSSSSSVAPPVMNSSSPMGPMSP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 19/53 (36%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:398351 19/96 (20%)
Homeobox 165..215 CDD:395001 20/54 (37%)
HALZ 217..260 CDD:128634 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.