DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HAT9

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_179865.1 Gene:HAT9 / 816811 AraportID:AT2G22800 Length:274 Species:Arabidopsis thaliana


Alignment Length:187 Identity:47/187 - (25%)
Similarity:76/187 - (40%) Gaps:44/187 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 GSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQ 326
            |:.:..:::||.:|.:...|.|..::     .::|.||:.:   ||:.|               :
plant    55 GADQLCRQTSSHSGVSSFSSGRVVKR-----ERDGGEESPE---EEEMT---------------E 96

  Fly   327 MTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLG 391
            ....|:.|.::.     .|.|   ||.|     .|..|...||:.|.....|:|..:..:|..|.
plant    97 RVISDYHEDEEG-----ISAR---KKLR-----LTKQQSALLEESFKDHSTLNPKQKQVLARQLN 148

  Fly   392 LSNAQVITWFQNRRAKQKRDIEELKKDFDSVKVFSAHKSFLENVNDLSILKKKPMHE 448
            |...||..|||||||:.|....|:..:|        .|...|.:.|.:|..:|.:.|
plant   149 LRPRQVEVWFQNRRARTKLKQTEVDCEF--------LKKCCETLADENIRLQKEIQE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 19/53 (36%)
HAT9NP_179865.1 HOX 112..166 CDD:197696 23/61 (38%)
HALZ 168..211 CDD:128634 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.