DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and lbx1

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001072559.1 Gene:lbx1 / 780014 XenbaseID:XB-GENE-6455157 Length:265 Species:Xenopus tropicalis


Alignment Length:194 Identity:86/194 - (44%)
Similarity:114/194 - (58%) Gaps:37/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 EQPTGSGKS-------NGDTPLDALFQMTTKDF--------DESQDKSHLDIFSNRPQPKKKRKS 356
            |:|..:|..       :..:||.||.::.:|.|        ..::.:..:.||..|..|||:|||
 Frog    64 EKPPAAGLPLSSRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKS 128

  Fly   357 RTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDS 421
            |||||||||:||||||||||||||||||:||..|||:||||||||||||||.|||:||:|.|.:|
 Frog   129 RTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVES 193

  Fly   422 VKVFSAHKSFLENVNDLSILKKK-------PMHESDMVGLAAAAAAAGMVVPVPGSVPMGGAPP 478
            ||..|  .|.:|.|..:|.|:::       ....|..:||:             |.:|:..:.|
 Frog   194 VKKMS--PSTVEAVLTISELEEETNSVRDDSRSRSPQLGLS-------------GHMPLSPSSP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 47/53 (89%)
lbx1NP_001072559.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
Homeobox 128..182 CDD:365835 47/53 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..265 6/44 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6422
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472248at2759
OrthoFinder 1 1.000 - - FOG0002643
OrthoInspector 1 1.000 - - mtm9428
Panther 1 1.100 - - LDO PTHR24336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5376
SonicParanoid 1 1.000 - - X3367
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.