DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Barhl2

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_075245.1 Gene:Barhl2 / 65050 RGDID:620726 Length:384 Species:Rattus norvegicus


Alignment Length:407 Identity:107/407 - (26%)
Similarity:156/407 - (38%) Gaps:108/407 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SGLTRSAVGNLPEDYFHPLKRLRMSSSSSEPRDHTPSPPSAVPEPQTNQTTKSAI--EGVKSFSI 136
            ||....:.|.:..| |..|...|.:...|:.   ||||.|.:....|..::..::  |..:...:
  Rat    19 SGAGSGSPGMMNGD-FRSLGEARTTDFRSQA---TPSPCSEIDTVGTAPSSPISVTLEPPEPHLV 79

  Fly   137 ADILGHSEKQREESVSPPPNANLLAPPAS--RPIAPSGGLLQPRTEPLDVHPAAAAAMLLPSGQI 199
            .|...|..........|||:    ||||.  :|........||::....:..||||.....|..:
  Rat    80 TDGPQHHHHLHHGQQPPPPS----APPAQSLQPSPQQQPPPQPQSAAQQLGSAAAAPRTSTSSFL 140

  Fly   200 VRPWDHLLGPTMPVRPFIPSALLHYEQRLALDYHRQLQEHFNAQAQLLRHMGMNPAIIASEDGSS 264
            ::   .:||.:.|:....|     |...::..:|...|| .||     .|....|. :..||..:
  Rat   141 IK---DILGDSKPLAACAP-----YSTSVSSPHHTPKQE-CNA-----AHESFRPK-LEQEDSKT 190

  Fly   265 ERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTT 329
            :..:|..|.: ..:|..          |.:||..|.  ..|.|.|          |:.|      
  Rat   191 KLDKREDSQS-DIKCHG----------TKEEGDREI--TSSRESP----------PVRA------ 226

  Fly   330 KDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSN 394
                                 ||.||:||||::||:.:||:.|..|||||..||.::||:|.|::
  Rat   227 ---------------------KKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTD 270

  Fly   395 AQVITWFQNRRAKQKR-------------DIEELKKDFDSVKVFSAHKSFLENVNDLSILKKKPM 446
            .||.||:||||.|.||             :...|::.|.|...:  |.|.|              
  Rat   271 TQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFY--HPSLL-------------- 319

  Fly   447 HESDMVGLAAAAAAAGM 463
              ..|....||||||.|
  Rat   320 --GSMDSTTAAAAAAAM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 29/53 (55%)
Barhl2NP_075245.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134 31/122 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..237 30/144 (21%)
Homeobox 233..285 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.