DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and vent

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_571775.1 Gene:vent / 64810 ZFINID:ZDB-GENE-010108-2 Length:170 Species:Danio rerio


Alignment Length:156 Identity:53/156 - (33%)
Similarity:66/156 - (42%) Gaps:31/156 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 SSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDES 335
            |.|....|.||  .|.....||...|:.:|        |.....|.|.|             |..
Zfish    12 SQSFHDQEKCS--TAAPGAPLTAAAGAGKA--------PASPANSCGYT-------------DVE 53

  Fly   336 QDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITW 400
            .|.|.::...|       |:.||.||..||..|||.|...:||....|.:||..|.||..||.||
Zfish    54 SDDSEVEAGQN-------RRVRTKFTCDQISGLEKSFSKHRYLGATQRRKIAEKLHLSETQVKTW 111

  Fly   401 FQNRRAKQKRDIEELK-KDFDSVKVF 425
            |||||.|.||:::::: .||....||
Zfish   112 FQNRRMKLKREVQDMRAADFLYPAVF 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 28/53 (53%)
ventNP_571775.1 Homeobox 68..120 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.