DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and BARHL1

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_064448.1 Gene:BARHL1 / 56751 HGNCID:953 Length:327 Species:Homo sapiens


Alignment Length:320 Identity:87/320 - (27%)
Similarity:128/320 - (40%) Gaps:93/320 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LLRHMGMNPAIIASE----DGSS--ERSQRSSSSNGSTECCSPRQAEK--LEKLTTQEGSEEAQK 302
            :|.|...:||:...:    |..|  |.|.||.|   |::|.||....:  ||..|.:.|......
Human    12 ILSHRAGSPALPKGDPLLGDCRSPLELSPRSES---SSDCSSPASPGRDCLETGTPRPGGASGPG 73

  Fly   303 KKSEEQP----------------------------------TGSGKSNGDTPLDALFQMTTKDFD 333
            ..|..||                                  :.||:.....|...|.....:||.
Human    74 LDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFR 138

  Fly   334 ESQDKS----------------HLDIFSNRPQP----KKKRKSRTAFTNHQIFELEKRFLYQKYL 378
            :..|||                ..:|.|:|..|    ||.||:|||||:||:.:||:.|..||||
Human   139 DKLDKSGSNASSDSEYKVKEEGDREISSSRDSPPVRLKKPRKARTAFTDHQLAQLERSFERQKYL 203

  Fly   379 SPADRDEIAASLGLSNAQVITWFQNRRAKQKR-------------DIEELKKDFDSVKVFSAHKS 430
            |..||.|:||||.|::.||.||:||||.|.||             :...|::.|.|...:.  :|
Human   204 SVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFYP--QS 266

  Fly   431 FLENVNDLSIL------------KKKPMHESDMV-GLAAAAAAAGMVVPVPGSVPMGGAP 477
            .:.|::..:.|            .::|:....:: ||..|:.....:.|:.|.:|....|
Human   267 LVSNLDPGAALYLYRGPSAPPPALQRPLVPRILIHGLQGASEPPPPLPPLAGVLPRAAQP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 32/53 (60%)
BARHL1NP_064448.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 22/80 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..184 18/71 (25%)
Homeobox 182..235 CDD:395001 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.