DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and lbx1a

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001020703.1 Gene:lbx1a / 564103 ZFINID:ZDB-GENE-040724-40 Length:269 Species:Danio rerio


Alignment Length:132 Identity:75/132 - (56%)
Similarity:92/132 - (69%) Gaps:14/132 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 EEQP-TGSGKSN-----GDTPLDALFQMTTKDF--------DESQDKSHLDIFSNRPQPKKKRKS 356
            |:.| ||...||     ..:||.||.::.:|.|        ..::.:..:.:|..|..|||:|||
Zfish    64 EKHPSTGHPLSNRALLTQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTLFGQRNTPKKRRKS 128

  Fly   357 RTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDS 421
            |||||||||:||||||||||||||||||:||..|||:||||||||||||||.|||:||:|.|.:|
Zfish   129 RTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVES 193

  Fly   422 VK 423
            .|
Zfish   194 AK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 47/53 (89%)
lbx1aNP_001020703.1 Homeobox 128..181 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574719
Domainoid 1 1.000 107 1.000 Domainoid score I6439
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472248at2759
OrthoFinder 1 1.000 - - FOG0002643
OrthoInspector 1 1.000 - - mtm6413
orthoMCL 1 0.900 - - OOG6_107037
Panther 1 1.100 - - LDO PTHR24336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5376
SonicParanoid 1 1.000 - - X3367
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.