DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and barhl1b

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001018142.1 Gene:barhl1b / 553186 ZFINID:ZDB-GENE-060118-2 Length:323 Species:Danio rerio


Alignment Length:388 Identity:102/388 - (26%)
Similarity:140/388 - (36%) Gaps:119/388 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SFSIADILGHSEKQREESVSPPPNANLLAPPASRPIAPSGGLLQPRTEPLDVHPAAAAAMLLPSG 197
            ||.|..:|.|.                   |.|..|:....|:.....||:..|.:.    |.||
Zfish     9 SFGIDSLLSHR-------------------PGSPVISKGDSLVGECRSPLEFSPRSD----LESG 50

  Fly   198 QIVRPWDHLLGPTMPVRPFIPSALLHYEQRLALDYHRQLQEHFNAQAQLLRH----MGMNPAIIA 258
                    ...|..|.|..:..|             .|.|.|..|.|..|:|    .|..|..:|
Zfish    51 --------CSSPPSPRRECVEDA-------------AQRQGHPLAYASHLQHGPISAGSQPRTVA 94

  Fly   259 SE--------DGSSERSQRSSSSNGSTECCSPRQAEK-----LEKLTTQEGSEEAQKKKSEEQPT 310
            |.        |.....:....||||.....:.|.|.|     :||:.:...|:...|.|.|    
Zfish    95 SSFLIRDILADCKPLAACAPYSSNGQPTQEAGRLASKIADDLIEKIHSNSSSDSEYKVKEE---- 155

  Fly   311 GSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQP----KKKRKSRTAFTNHQIFELEKR 371
                  ||.                      :|.|:|..|    ||.||:|||||:||:.:||:.
Zfish   156 ------GDR----------------------EISSSRDSPQVRLKKPRKARTAFTDHQLAQLERS 192

  Fly   372 FLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR-------------DIEELKKDFDSVK 423
            |..|||||..||.|:||||.|::.||.||:||||.|.||             :...|::.|.|..
Zfish   193 FERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPY 257

  Fly   424 VFSAHKSFLENVNDLSIL-------KKKPMHESDMVGLAAAAAAAGMVVPVPGSVPMGGAPPK 479
            .:.  :|.:.|::..:.|       ...|..:..:|.........|...|.|...|:.|..|:
Zfish   258 FYP--QSLVSNLDPGAALYLYRGPSAPPPALQRPLVPRILLHGLQGASEPPPPLPPLSGVLPR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 32/53 (60%)
barhl1bNP_001018142.1 Oxidoreductase_nitrogenase 48..>88 CDD:295466 13/60 (22%)
Homeobox 178..230 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.