DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Dbx2

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_001053826.1 Gene:Dbx2 / 541457 RGDID:1359605 Length:377 Species:Rattus norvegicus


Alignment Length:431 Identity:96/431 - (22%)
Similarity:131/431 - (30%) Gaps:175/431 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LPEDYFHPLKRLR----MSSSSSEPRDHTPSPP-----SAVPEPQTNQ-------TTKSAIEGV- 131
            |||........||    ..:.|..||..:|..|     :.:|.....|       ...||:.|: 
  Rat    25 LPEALLRAKDALRSPDPAGALSRSPRTRSPRLPGQRARTMLPSAVAAQAGAYWDVVASSALLGLP 89

  Fly   132 --------KSFSIADILGHSEKQREESVSPPPNANLLAPPASRPIA----PSGGLLQPRTEPLDV 184
                    |||.|.::|        .:.:.|.:    |||:.||.|    |....|.....||.:
  Rat    90 APGFGSLGKSFLIENLL--------RAGAGPTH----APPSPRPAAGPECPQLRSLPANPVPLKL 142

  Fly   185 HPA----AAAAMLLPSGQIVRPWDHLLGPTMPV--RPFIPSALLHYEQRLALDYHRQLQEHFNAQ 243
            .||    |..|..:|.|:.....|....|:.||  :||:.||...|                   
  Rat   143 CPAGPFGARWAFQMPPGRAPGERDSAFQPSAPVPSKPFLLSAGPFY------------------- 188

  Fly   244 AQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQ 308
                                             :.||.              ||     .:....
  Rat   189 ---------------------------------SACCG--------------GS-----CRRPAS 201

  Fly   309 PTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFL 373
            ||...:.....||      .|:|   |..|:...|.           .|..|:..|...|||.|.
  Rat   202 PTAFSREEHGLPL------LTQD---SNSKARRGIL-----------RRAVFSEDQRKALEKMFQ 246

  Fly   374 YQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSVKVFSAHKSFLENVNDL 438
            .|||:|..||.::|.||||..:||..||||||.|.:.               |..|..|.|    
  Rat   247 KQKYISKTDRRKLAISLGLKESQVKIWFQNRRMKWRN---------------SKEKEVLSN---- 292

  Fly   439 SILKKKPMHESDMVGLAAAAAAAGMVVPVPGSVPMGGAPPK 479
            ..|::..:.|..:                  :.|..|.||:
  Rat   293 RCLQEVSLQEDRL------------------AQPAAGCPPQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 27/53 (51%)
Dbx2XP_001053826.1 Homeobox 229..282 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.