DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HGTX

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster


Alignment Length:518 Identity:127/518 - (24%)
Similarity:178/518 - (34%) Gaps:169/518 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LCPPTMRPASPAESEISVGGAPSPLPTQHH-----------THPHSHPHPLQHPRASTIDLLQQQ 55
            |..|.||..|.|   .:..|:|.....:||           .|.|:         .:..|  .||
  Fly    77 LINPYMRHHSFA---AAAQGSPPSAAQRHHLAAAMSNGFADVHAHA---------MAAAD--YQQ 127

  Fly    56 QLLMQHHAAAAAAAAAAASGLTRSAVGNLPEDYFHPLKRLRMSS----SSSEPRDHTPSPPS--- 113
            ||...|.||||||..|..:....:...|  .:...||..|:.:.    ..|:....||.|.|   
  Fly   128 QLADYHSAAAAAAVYANNNNNNNNNSSN--NNNSSPLMLLKAAHGGGLKDSDSPSTTPPPASSRL 190

  Fly   114 ---AVPEPQTNQTTKSAIEGVKSFSIADILGHSEK--QREESVSPPPNA-NLLAPPASRPIAPSG 172
               :.|.|:....:...::..||::::.....:|.  |..||.||||.. |..:|.         
  Fly   191 HSDSSPSPRYEHNSSPGVDSAKSYALSQRSSGAEDPCQTSESASPPPQGQNDYSPE--------- 246

  Fly   173 GLLQPRTE--------PLDVHPAAAAAMLLPSGQIVRP--------WDH-----LLGPTMPVRPF 216
            .|...|.:        ||.:|.|..|.         .|        .||     .|||       
  Fly   247 NLSSQRAKFQHHHGVNPLALHNANHAG---------NPGCHNNNNHMDHKLPLSFLGP------- 295

  Fly   217 IPSALLHYEQRLALDYHRQLQEHFNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCS 281
             |.|.||   .:..:...|.....:|.|..|.:.....:.:.|:.||.     .|||:.||    
  Fly   296 -PLAALH---SMTTEMKGQGVGGSSASANGLSYSHSPNSHLISDRGSG-----GSSSSSST---- 347

  Fly   282 PRQAEKLEKLTTQEGSEEAQKKK------SEEQP---------TGSG------------------ 313
                     .||...|:.|....      |:..|         ||:|                  
  Fly   348 ---------TTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLS 403

  Fly   314 KSNGDTPLD-------------------------ALFQMTTKDFDESQDKSHLDIFSNRPQPKKK 353
            :|.| .||.                         |..:..:.....:..:||....||....|||
  Fly   404 QSQG-APLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKK 467

  Fly   354 RKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAK-QKRDIEEL 415
            . :|..|:..|||.|||.|...|||:..:|.::|.:||:|.:||..||||||.| :||...|:
  Fly   468 H-TRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEM 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 26/54 (48%)
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 56/255 (22%)
Homeobox 469..523 CDD:395001 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.