DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Tlx3

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_573065.4 Gene:Tlx3 / 497881 RGDID:1564190 Length:291 Species:Rattus norvegicus


Alignment Length:370 Identity:96/370 - (25%)
Similarity:135/370 - (36%) Gaps:117/370 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SSSSEPRDHTPSPPSAVPEPQTNQTTKSAIEGVKSFSIADILGHSEKQREESVSPPPNANLL-AP 162
            :|:..|..|.|.                      ||.|..||...::....:...|..|:.| .|
  Rat     5 ASAQTPHPHEPI----------------------SFGIDQILNSPDQDSAPAPRGPDGASYLGGP 47

  Fly   163 PASRPIA--PS-----GGLLQPRTEPLDVHPAAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPSA 220
            |..||.|  ||     .||..|..   |....:....|.|:|.|..|....|...:|  |.:|||
  Rat    48 PGGRPGAAYPSLPASFAGLGAPFE---DAGSYSVNLSLAPAGVIRVPAHRPLPGAVP--PPLPSA 107

  Fly   221 LLHYEQRLALDYHRQLQEHFNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQA 285
            |                                ||:         .|..:.||.|..        
  Rat   108 L--------------------------------PAM---------PSVPTVSSLGGL-------- 123

  Fly   286 EKLEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQP 350
                .....|.|....|.:.             |...||...|.     ::...|  .:.||..|
  Rat   124 ----NFPWMESSRRFVKDRF-------------TAAAALTPFTV-----TRRIGH--PYQNRTPP 164

  Fly   351 KKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR----D 411
            |:| |.||:|:..||.||||||..||||:.|:|..:|.||.:::|||.|||||||.|.:|    :
  Rat   165 KRK-KPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEE 228

  Fly   412 IEELKKDFDSVKVFSAHKSFLENVNDLSILKKKP--MHESDMVGL 454
            .|..::....:.:...|.:|.:::||  .::..|  :|.|.:..|
  Rat   229 REAERQQASRLMLQLQHDAFQKSLND--SIQPDPLCLHNSSLFAL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 31/53 (58%)
Tlx3XP_573065.4 Homeobox 169..223 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.