DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and NKX2-2

DIOPT Version :10

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_002500.1 Gene:NKX2-2 / 4821 HGNCID:7835 Length:273 Species:Homo sapiens


Alignment Length:132 Identity:31/132 - (23%)
Similarity:52/132 - (39%) Gaps:35/132 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 RLSRYYTFGRMLVKLAEAIGRLVLAGREMSRLAGFTARMTELTVVL---KDLNSGRYERTMVNNS 418
            :|.|..|.|.   .|.|::..|:.:.:...:||        |.|:|   |.:||...:|  |.|.
Human     4 QLYRNTTLGN---SLQESLDELIQSQQITPQLA--------LQVLLQFDKAINSALAQR--VRNR 55

  Fly   419 AIADAGDIGPGRGLL---KFQDNLIKFEHVPLVTPNGDVLVKDLTFEVK-SGMNVLVCGPNGCGK 479
            .        ..||.|   :|.||:..|       ...||..:::|..:| ..:.::.|.....|.
Human    56 V--------NFRGSLNTYRFCDNVWTF-------VLNDVEFREVTELIKVDKVKIVACDGKNTGS 105

  Fly   480 SS 481
            ::
Human   106 NT 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeodomain 354..410 CDD:459649 15/55 (27%)
NKX2-2NP_002500.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 18/64 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 2/18 (11%)
Homeodomain 129..185 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.