DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and slou

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster


Alignment Length:475 Identity:113/475 - (23%)
Similarity:155/475 - (32%) Gaps:174/475 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLPTQHHTHPHSHPHPLQHPRASTIDLLQQQQLLMQHHAAAAAAAAAAASGLTRSAVGNLPEDYF 89
            |.....|.|||.||||..||..|.:                                       |
  Fly   213 PAHPHSHQHPHPHPHPHPHPHPSAV---------------------------------------F 238

  Fly    90 HPLKRLRMSSSSSEPRDHTPSPPSAVPEPQTNQTTKSAIEGVKSFSIADILGHSEKQREESVSPP 154
            |    ||..||||      .:|||....|.:..|:.:.              ||::|....::||
  Fly   239 H----LRAPSSSS------TAPPSPATSPLSPPTSPAM--------------HSDQQMSPPIAPP 279

  Fly   155 PNANLLAPPASRP------IAPSG---------GLLQPRTEPLDVHPAAAAAMLLPSGQIVRPWD 204
            .|    .|.:|:|      .|||.         ..:..||.......|.|:|....|...:...:
  Fly   280 QN----PPHSSQPPQQQQVAAPSDMDLERIKLVAAVAARTTQASSTSALASASNSVSNASISISN 340

  Fly   205 HLLGPTMPVRPFIPSA--LLHYEQRLALD-----------YHRQLQEHFNAQAQLLRHMGMNPAI 256
            ...|.        ||.  |..|..|:.|.           ..||:.....|::.....:.::...
  Fly   341 SSSGS--------PSGRDLSDYGFRIQLGGLAAAAAAAAATSRQIAAATYARSDTSEELNVDGND 397

  Fly   257 IASEDGSSE----------RSQRSSS----SNGSTECCSPRQA---------EKL---EKLT--- 292
            ..|.|||..          ||..||:    |:.||...|.|.|         |.:   .|.|   
  Fly   398 EDSNDGSHSTPSVCPVDLTRSVNSSAAANPSSASTSASSDRDAATKRLAFSVENILDPNKFTGNK 462

  Fly   293 ------------TQEGSEEAQKKKSEEQPTG-SGKSNGDTPLDALFQMTTKDFDESQDKSHLDIF 344
                        :.|..||.|::..::|... |.:...|...|          |...|.|.:|..
  Fly   463 LPSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQD----------DMCDDGSDIDDP 517

  Fly   345 SNRPQPK-------------------KKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASL 390
            |:....|                   |.|::|||||..|:..||.:|...:|||..:|..:|.||
  Fly   518 SSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSL 582

  Fly   391 GLSNAQVITWFQNRRAKQKR 410
            .|:..||..||||||.|.|:
  Fly   583 SLTETQVKIWFQNRRTKWKK 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 26/53 (49%)
slouNP_001262808.1 Homeobox 549..601 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.