DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and ventx1.2

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_988861.1 Gene:ventx1.2 / 394455 XenbaseID:XB-GENE-920868 Length:262 Species:Xenopus tropicalis


Alignment Length:203 Identity:66/203 - (32%)
Similarity:86/203 - (42%) Gaps:45/203 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RPFIPSALLHYEQRLA-LDYHRQLQEHFNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGST 277
            ||.||.|    .|.|| ..|.:::....:.|.|         ..|.|...|||.::....||.| 
 Frog    29 RPHIPCA----PQPLAPTKYAKEIPRRKDGQEQ---------GEITSFQCSSEEARNRQFSNPS- 79

  Fly   278 ECCSPRQAEKLEKLTTQEG-SEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHL 341
                      |..|....| |:|.....||:..|.|...|                .:..|..|.
 Frog    80 ----------LPALHRSSGSSDEFSPAGSEDDGTESSGRN----------------SQENDTEHR 118

  Fly   342 DIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRA 406
               |..|:...:|:.|||||..||..||:.|..|:||..::|.::|.||.||..||.|||||||.
 Frog   119 ---SKSPKSDLQRRLRTAFTPQQITRLEQAFNKQRYLGASERKKLATSLQLSEIQVKTWFQNRRM 180

  Fly   407 KQKRDIEE 414
            |.||.|::
 Frog   181 KLKRQIQD 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 29/53 (55%)
ventx1.2NP_988861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..129 33/142 (23%)
Homeobox 131..183 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.