DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Barx1

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001102350.1 Gene:Barx1 / 364680 RGDID:1310884 Length:254 Species:Rattus norvegicus


Alignment Length:309 Identity:80/309 - (25%)
Similarity:108/309 - (34%) Gaps:116/309 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 EPRDHTPSPPSAVPEPQTNQTTKSAIEGVKSFSIADILGHSEKQREESVSPPPNANLLAPPASRP 167
            ||......||....:.:.::        .:||.|           ||.::.||.....||.|:  
  Rat     6 EPGSARFGPPEGCADHRPHR--------YRSFMI-----------EEILTEPPGPKGAAPAAA-- 49

  Fly   168 IAPSGGLLQPRTEPLDVHPAAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPS-ALLHYEQRLALD 231
                               ||||..||..|         :...:..|||... |:|..||...  
  Rat    50 -------------------AAAAGELLKFG---------VQALLAARPFHSHLAVLKAEQAAV-- 84

  Fly   232 YHRQLQEHFNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEG 296
                    |......|...|:..|::|:..|       ...:.|::..  |.:.:...||     
  Rat    85 --------FKFPLAPLGCSGLGSALLAAGPG-------MPGTAGTSHL--PLELQLRGKL----- 127

  Fly   297 SEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFT 361
                       :..|||:..            ||                   .||.|:|||.||
  Rat   128 -----------EAAGSGEPG------------TK-------------------AKKGRRSRTVFT 150

  Fly   362 NHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR 410
            ..|:..|||||..|||||..||.::|.|||||..||.||:||||.|.|:
  Rat   151 ELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 33/53 (62%)
Barx1NP_001102350.1 Homeobox 145..198 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.