DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and BARHL2

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_064447.1 Gene:BARHL2 / 343472 HGNCID:954 Length:387 Species:Homo sapiens


Alignment Length:421 Identity:110/421 - (26%)
Similarity:163/421 - (38%) Gaps:128/421 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AAAASGLTRSAVGNLPEDYFHPLKRLRMSSSSSEPRDHTPSPPSAVPEPQTNQTTKSAI--EGVK 132
            ::|:||    :.|.:..| |.||...|.:...|:.   ||||.|.:....|..::..::  |..:
Human    18 SSASSG----SPGMMNGD-FRPLGEARTADFRSQA---TPSPCSEIDTVGTAPSSPISVTMEPPE 74

  Fly   133 SFSIADILGHSEKQREESVSPPPNANLLAPPAS--------RPIAPSGGLLQPRTEPLDVHPAAA 189
            ...:||...|..........|||.|   ||..|        :|:.|.   ..|...|..:..||:
Human    75 PHLVADATQHHHHLHHSQQPPPPAA---APTQSLQPLPQQQQPLPPQ---QPPPPPPQQLGSAAS 133

  Fly   190 AAMLLPSGQIVRPWDHLLGPTMPVRPFIPSALLHYEQRLALDYHRQLQEHFNAQAQLLRHMGMNP 254
            |.....|..:::   .:||.:.|:....|     |...::..:|...||                
Human   134 APRTSTSSFLIK---DILGDSKPLAACAP-----YSTSVSSPHHTPKQE---------------- 174

  Fly   255 AIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDT 319
                              ||...|...|    |||    ||.|:....|:.:.|  ...|.:|  
Human   175 ------------------SNAVHESFRP----KLE----QEDSKTKLDKREDSQ--SDIKCHG-- 209

  Fly   320 PLDALFQMTTKDFDESQDKSHLDIFSNRPQP----KKKRKSRTAFTNHQIFELEKRFLYQKYLSP 380
                           ::::...:|.|:|..|    ||.||:||||::||:.:||:.|..|||||.
Human   210 ---------------TKEEGDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSV 259

  Fly   381 ADRDEIAASLGLSNAQVITWFQNRRAKQKR-------------DIEELKKDFDSVKVFSAHKSFL 432
            .||.::||:|.|::.||.||:||||.|.||             :...|::.|.|...:  |.|.|
Human   260 QDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFY--HPSLL 322

  Fly   433 ENVNDLSILKKKPMHESDMVGLAAAAAAAGM 463
                            ..|....||||||.|
Human   323 ----------------GSMDSTTAAAAAAAM 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 29/53 (55%)
BARHL2NP_064447.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..145 35/140 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..240 30/148 (20%)
Homeobox 236..288 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..387
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.