DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and hlx1

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_009293289.1 Gene:hlx1 / 327096 ZFINID:ZDB-GENE-030131-5304 Length:357 Species:Danio rerio


Alignment Length:385 Identity:89/385 - (23%)
Similarity:144/385 - (37%) Gaps:113/385 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AIEGVK--SFSIADIL--GHSEK-QREESVSPPPNANLLAPPASRPIAPSGGLLQPRTEPLDVHP 186
            |::.:|  ||.|||||  |.:|. |...|:.....|......:..|:.||     |.|....:||
Zfish    26 AVDSMKKPSFCIADILHVGDAENIQGSSSLMAHIGARAQVHSSGSPLRPS-----PVTPDARLHP 85

  Fly   187 AAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPSALLHY--EQRLALDYH---------RQLQEHF 240
            |           .:|...||........|...|..|.:  ::.|:.|:.         |.|....
Zfish    86 A-----------YLRHGIHLTSRAAINAPPPTSKDLKFGIDRILSTDFEPKSKESPSLRDLTSIV 139

  Fly   241 NAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKS 305
            :...|...|:..:|...:.:...||    :||..||.                  |:...|..:.
Zfish   140 SPNRQSAVHVSASPYFASIDPTMSE----TSSLMGSI------------------GNAARQSGQH 182

  Fly   306 EEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRK--SRTAFTNHQIFEL 368
            :.|.|..|:.         :.:.:||              ..||..|:::  ||..|:|.|...|
Zfish   183 QFQDTFPGRP---------YAVLSKD--------------TMPQTYKRKRSWSRAVFSNLQRKGL 224

  Fly   369 EKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR--------------------DIE 413
            ||||..|||::..||.::||.|||::|||..||||||.|.:.                    :.|
Zfish   225 EKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKEKEQPDKSAAETE 289

  Fly   414 ELKKDFDSVKVFSAHKSFLENVNDLSILKKKPMHESDMVGLAAAAAAAGMVVPVPGSVPM 473
            :.::|....:...:...|.:...|.|.:....::::.::              :||.:|:
Zfish   290 QKERDDSECETEPSESEFEDGPEDKSDVDISDLNKASVI--------------IPGPLPV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 30/53 (57%)
hlx1XP_009293289.1 Homeobox 212..265 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.