DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HOXC12

DIOPT Version :10

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_776272.1 Gene:HOXC12 / 3228 HGNCID:5124 Length:282 Species:Homo sapiens


Alignment Length:63 Identity:26/63 - (41%)
Similarity:38/63 - (60%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 PQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR 410
            |...:.||.|..::..|:.|||..||..::::...|.|::..|.||:.||..||||||.|:||
Human   209 PINSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeodomain 354..410 CDD:459649 23/55 (42%)
HOXC12NP_776272.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..129
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..214 1/4 (25%)
Homeodomain 215..271 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.