DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HOXC10

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_059105.2 Gene:HOXC10 / 3226 HGNCID:5122 Length:342 Species:Homo sapiens


Alignment Length:451 Identity:95/451 - (21%)
Similarity:152/451 - (33%) Gaps:142/451 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLCPPTMRPASPAESEISVGGAPSPLPTQHHTHPHSHPHPLQHPRASTIDLLQQQQLLMQHHA-- 63
            |.||..:.|.|.||...:.||..                  ::.|::        .:.||..:  
Human     1 MTCPRNVTPNSYAEPLAAPGGGE------------------RYSRSA--------GMYMQSGSDF 39

  Fly    64 -AAAAAAAAAASGLTRSAVGNLP--------------EDYFHPLKRLRMSSSSSEPRDHTPSPPS 113
             .........|..|::...|:.|              :.:..|....|:......|......|||
Human    40 NCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQLDSWGDPKAAYRLEQPVGRPLSSCSYPPS 104

  Fly   114 AVPEPQTNQTTKSAIEGVKSFSIADILGHSEKQREESVSPPPNANLLAPPASR--------PIAP 170
                             ||..::..:  :|.::|.:|   .|.|.|.:.|...        |: |
Human   105 -----------------VKEENVCCM--YSAEKRAKS---GPEAALYSHPLPESCLGEHEVPV-P 146

  Fly   171 SGGLLQPRTEPLDVHPAAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPSALLHYEQRLALDYHRQ 235
            |.....|....||..|                  |..|......||        |||.:|     
Human   147 SYYRASPSYSALDKTP------------------HCSGANDFEAPF--------EQRASL----- 180

  Fly   236 LQEHFNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGS-EE 299
                 |.:|:.|....:...:...|...|:           ::..||.:.:..:.|...:|| .|
Human   181 -----NPRAEHLESPQLGGKVSFPETPKSD-----------SQTPSPNEIKTEQSLAGPKGSPSE 229

  Fly   300 AQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQ 364
            ::|::::...:....|:.:...:...:.||               .|....|..||.|..:|.||
Human   230 SEKERAKAADSSPDTSDNEAKEEIKAENTT---------------GNWLTAKSGRKKRCPYTKHQ 279

  Fly   365 IFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR-----DIEELKKDFD 420
            ..||||.||:..||:...|.||:.::.|::.||..||||||.|.|:     .|.||..:|:
Human   280 TLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 25/53 (47%)
HOXC10NP_059105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..271 16/109 (15%)
Homeobox 271..324 CDD:306543 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.