DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HOXC9

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_008828.1 Gene:HOXC9 / 3225 HGNCID:5130 Length:260 Species:Homo sapiens


Alignment Length:302 Identity:69/302 - (22%)
Similarity:108/302 - (35%) Gaps:71/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SAIEGVKSFSIADILGHSEKQREESVSPPPNANLLAPPASRP--------------IAPSGGLLQ 176
            ||...:.::.:..::.|..:....|..|...|:   |.|:||              .||...:..
Human     2 SATGPISNYYVDSLISHDNEDLLASRFPATGAH---PAAARPSGLVPDCSDFPSCSFAPKPAVFS 63

  Fly   177 PRTEPLDVHPAAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIP--SALLHYEQRLALDYHRQLQEH 239
            ....|:   |:.::.:..|.|    |..||...|..:|.::.  |..:.:..             
Human    64 TSWAPV---PSQSSVVYHPYG----PQPHLGADTRYMRTWLEPLSGAVSFPS------------- 108

  Fly   240 FNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSE-EAQKK 303
            |.|..   ||..:.|                .:..|....|.|.:.......  ..||. |.:.:
Human   109 FPAGG---RHYALKP----------------DAYPGRRADCGPGEGRSYPDY--MYGSPGELRDR 152

  Fly   304 KSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFEL 368
            ..:..|:...        |||  ..:|..:|..|....:..:|....:..||.|..:|.:|..||
Human   153 APQTLPSPEA--------DAL--AGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLEL 207

  Fly   369 EKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR 410
            ||.||:..||:...|.|:|..|.|:..||..||||||.|.|:
Human   208 EKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 25/53 (47%)
HOXC9NP_008828.1 Hox9_act 1..179 CDD:368024 40/230 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..181 14/88 (16%)
HOX 192..241 CDD:197696 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.