DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HOXB9

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_076922.1 Gene:HOXB9 / 3219 HGNCID:5120 Length:250 Species:Homo sapiens


Alignment Length:310 Identity:81/310 - (26%)
Similarity:108/310 - (34%) Gaps:79/310 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AIEG-VKSFSIADILGHSEKQREESVSPPPNANLLAPPASRPIAPSGGLLQPRTEPLDVHPAAAA 190
            :|.| :.|:.:..|:.|..:.              ||||.   .|||.....|      .|..|.
Human     2 SISGTLSSYYVDSIISHESED--------------APPAK---FPSGQYASSR------QPGHAE 43

  Fly   191 AMLLPSGQIVRPWDHLLGPTMPV-----RPFIPSALLHYEQRLALDYHRQLQEHFNAQAQLLRHM 250
            .:..||..        ..|..||     .|..|    |....|...||..:|.           .
Human    44 HLEFPSCS--------FQPKAPVFGASWAPLSP----HASGSLPSVYHPYIQP-----------Q 85

  Fly   251 GMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGSGK- 314
            |:.||     :....|:....:..|.......:.|.|.|.|....|....|........|.:|: 
Human    86 GVPPA-----ESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGRE 145

  Fly   315 ---SN-----GDTPLDALFQMTTKDFDESQDKSHLD---IFSNRPQPKKKRKSRTAFTNHQIFEL 368
               ||     ||          .|..:.|:||...|   ..:|....:..||.|..:|.:|..||
Human   146 AVLSNQRPGYGD----------NKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLEL 200

  Fly   369 EKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKD 418
            ||.||:..||:...|.|:|..|.||..||..||||||.|.|:..:|..|:
Human   201 EKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 26/53 (49%)
HOXB9NP_076922.1 Hox9_act 1..172 CDD:282473 48/230 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47 10/48 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..182 10/42 (24%)
Homeobox 188..241 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.