DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and HOXA7

DIOPT Version :10

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_008827.2 Gene:HOXA7 / 3204 HGNCID:5108 Length:230 Species:Homo sapiens


Alignment Length:62 Identity:28/62 - (45%)
Similarity:39/62 - (62%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 PKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRD 411
            |.:|| .|..:|.:|..||||.|.:.:||:...|.|||.:|.|:..|:..||||||.|.|::
Human   128 PDRKR-GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeodomain 354..410 CDD:459649 25/55 (45%)
HOXA7NP_008827.2 Antp-type hexapeptide 119..124
Homeodomain 131..187 CDD:459649 26/56 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..230 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.