DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and dbx1b

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_571253.1 Gene:dbx1b / 30416 ZFINID:ZDB-GENE-000128-11 Length:322 Species:Danio rerio


Alignment Length:329 Identity:78/329 - (23%)
Similarity:122/329 - (37%) Gaps:96/329 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 NLLAPPASRP--IAPSGGLLQPRTEPLDVHPAAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPSA 220
            :::||||..|  :.||..|..|        ||..:|....|..:|   :.||      |...|:|
Zfish     5 SVIAPPAMYPSFLRPSSALSLP--------PALQSAFTTHSSFLV---EDLL------RISRPAA 52

  Fly   221 LLHYEQRLALDYHRQLQE-----------HFNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSN 274
            .:          ||.:..           ..|..:..: |:.|:.|:  ::..||.::..||..|
Zfish    53 FM----------HRSIPSPSASPPATGVTTLNTTSSAV-HVAMSTAL--AKRSSSPQTSISSDPN 104

  Fly   275 ----GSTECCSPRQAEKLEKLTTQEGSE----EAQKKKSEEQPTGSGK------------SNGDT 319
                |         ...:...||:..|.    :....|:...|...|.            |:...
Zfish   105 YLKFG---------VNAILASTTRNASPPPPVQGMNAKTFPFPCFDGSFHPFIRASYFPASSSAV 160

  Fly   320 PLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRD 384
            |:...|...               .:.|.:|::....|..|::.|...|||.|..|||:|..||.
Zfish   161 PIPGTFAWP---------------LTARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRK 210

  Fly   385 EIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSVKVFSAHKSFLE---NVN-DLSILKKKP 445
            ::|..|||.::||..||||||.|.:.     .|:.:.:......:..|.   |.| |||.:.|:.
Zfish   211 KLATKLGLKDSQVKIWFQNRRMKWRN-----SKERELLSSGGCREQTLPTKMNPNPDLSDVGKRF 270

  Fly   446 MHES 449
            .||:
Zfish   271 EHEA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 26/53 (49%)
dbx1bNP_571253.1 COG5576 <173..296 CDD:227863 38/107 (36%)
Homeobox 182..235 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..266 7/27 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.